PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10018691m
Common NameEUTSA_v10018691mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 389aa    MW: 44470.2 Da    PI: 5.6176
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10018691mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.46e-211053245
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     + en + rqvt++kR++gi+KKA+ELS+LCd++v +++fs+ gk
  Thhalv10018691m 10 KLENLTARQVTYAKRKHGIIKKAKELSILCDVDVVLLMFSPVGK 53
                     67999************************************997 PP

2K-box22.74.2e-091461894790
            K-box  47 slkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                      ++ +LqqLe+ L ksl +iR++K ++l  q ++ q +  e +++
  Thhalv10018691m 146 NVDDLQQLENSLRKSLYQIRAHKVNMLQVQHQQDQFMSSECKNQ 189
                      689***************************99999888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554557.06E-24181IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-28160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.025153IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-17323IPR002100Transcription factor, MADS-box
PfamPF003194.3E-181153IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRVKLKIKK LENLTARQVT YAKRKHGIIK KAKELSILCD VDVVLLMFSP VGKASLCCGK  60
HSIGEVIAKF AQLTPQERAK RLYTESNYFV FSSCLRLNRK LETLEVSGFA WLCLALKKTF  120
IKLDHDVNIA EFLDRSYWTE LEKIDNVDDL QQLENSLRKS LYQIRAHKVN MLQVQHQQDQ  180
FMSSECKNQL QNDIDLDFGM EMEQQLESFS WVRNDENMNV PVKEKDPNPQ FHHTYNDITN  240
VALKEEDPNL QFHHTYNVIT NVNVEEEDPN PQFHHTYNDL TCSASSSLES YSGLFGKSSD  300
TSRPKLETGG IPGTSADPNL QFSNLSFLDD SKLQQLAEWN LLGTPADYYV SQILEASYRP  360
QFGGNWASSE TLTTYPVSVF DEPLFSRV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391001.10.0hypothetical protein EUTSA_v10018691mg
TrEMBLV4KEN60.0V4KEN6_EUTSA; Uncharacterized protein
STRINGBra004393.1-P1e-156(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149561620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69540.11e-148AGAMOUS-like 94